PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g011938m
Common NameCISIN_1g011938mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family MYB
Protein Properties Length: 475aa    MW: 51737.8 Da    PI: 5.9878
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g011938mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.26.9e-173885148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT  Ed +l+d+vk++G g+W+++ +  g+ R++k+c++rw ++l
  orange1.1g011938m 38 KGPWTSAEDAILIDYVKKHGEGNWNAVQKNSGLFRCGKSCRLRWANHL 85
                       79******************************************9986 PP

2Myb_DNA-binding538.2e-1791134146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        +g++T+eE++ +v++++++G++ W++ a++++ gRt++++k++w++
  orange1.1g011938m  91 KGAFTQEEEQMIVELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 134
                        799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.8163385IPR017930Myb domain
SMARTSM007178.9E-153787IPR001005SANT/Myb domain
SuperFamilySSF466893.74E-3037132IPR009057Homeodomain-like
PfamPF002499.1E-153885IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-233992IPR009057Homeodomain-like
CDDcd001671.42E-114085No hitNo description
PROSITE profilePS5129426.16986140IPR017930Myb domain
SMARTSM007177.8E-1790138IPR001005SANT/Myb domain
PfamPF002491.8E-1591134IPR001005SANT/Myb domain
CDDcd001672.74E-1293134No hitNo description
Gene3DG3DSA:1.10.10.603.5E-2693139IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MSCSSNGSDD MMLSNDQTDS PLMDEGGGGT ARGVILKKGP WTSAEDAILI DYVKKHGEGN  60
WNAVQKNSGL FRCGKSCRLR WANHLRPNLK KGAFTQEEEQ MIVELHAKMG NKWARMAAHL  120
PGRTDNEIKN YWNTRIKRRQ RAGLPLYPPE VSFQALQESQ CQNINGINSG DKGHHDLLQA  180
NGYEIPDVVF DSLKANQGVL PYVPDIPDIT ASTMLMKGLG SQYCSFVPPV MHRPKRLRES  240
VPLFSAYGGS VKNEFSFDQF HNDTSDKIAR SFGLSFPLDP DTTPKAPESF GMLQGSHTLS  300
NGNFSASKPN LGAVKLELPS LQYTETDLGS WGTSSPQPLL ETVDAFIQSP PPTGTLDSGC  360
PSPRNSGLLD ALIHESNTLK NHSSDKSSNS SSVTPDVADS CTRNFCETEW EDYSDPLSPL  420
GHSATSLFNE CTPLSASGSS LDEQAPVETF GKHLHLILII TLKGHSGTFE SSFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-32361395107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00348DAPTransfer from AT3G11440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006471261.10.0PREDICTED: transcription factor GAMYB
RefseqXP_006471263.10.0PREDICTED: transcription factor GAMYB
RefseqXP_015383648.10.0PREDICTED: transcription factor GAMYB
SwissprotQ0JIC21e-133GAM1_ORYSJ; Transcription factor GAMYB
SwissprotA2WW871e-133GAM1_ORYSI; Transcription factor GAMYB
TrEMBLA0A067E9870.0A0A067E987_CITSI; Uncharacterized protein
STRINGVIT_13s0067g01630.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.11e-122myb domain protein 65